PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB02G13290.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 69aa    MW: 8132.37 Da    PI: 11.7134
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB02G13290.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox60.52.7e-19256256
                  T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
      Homeobox  2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                  rk+ ++t+eq + Le+ F+ +  +s+++++eLA + gL+ rqV vWFqNrRa+ k
  OB02G13290.1  2 RKKLRLTREQATLLEDSFRAHTILSHAQKQELAGRAGLSARQVEVWFQNRRARTK 56
                  678899***********************************************98 PP

2HD-ZIP_I/II94.21.4e-30269168
   HD-ZIP_I/II  1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkr 68
                  +kk+rl++eq++lLE+sF++++ L++ +K+ela + gl++rqv+vWFqnrRARtk+kq+E d++ L+r
  OB02G13290.1  2 RKKLRLTREQATLLEDSFRAHTILSHAQKQELAGRAGLSARQVEVWFQNRRARTKLKQTEADCDLLRR 69
                  69****************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003896.0E-12162IPR001356Homeobox domain
PROSITE profilePS5007117.103158IPR001356Homeobox domain
CDDcd000866.49E-10259No hitNo description
PfamPF000461.0E-16256IPR001356Homeobox domain
SuperFamilySSF466892.05E-18266IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.9E-18263IPR009057Homeodomain-like
PRINTSPR000313.2E-62938IPR000047Helix-turn-helix motif
PROSITE patternPS0002703356IPR017970Homeobox, conserved site
PRINTSPR000313.2E-63854IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 69 aa     Download sequence    Send to blast
MRKKLRLTRE QATLLEDSFR AHTILSHAQK QELAGRAGLS ARQVEVWFQN RRARTKLKQT  60
EADCDLLRR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15058RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0054122e-53AP005412.3 Oryza sativa Japonica Group genomic DNA, chromosome 2, BAC clone:OSJNBa0050G13.
GenBankAP0149582e-53AP014958.1 Oryza sativa Japonica Group DNA, chromosome 2, cultivar: Nipponbare, complete sequence.
GenBankCP0126102e-53CP012610.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 2 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015688453.12e-41PREDICTED: putative homeobox-leucine zipper protein HOX26
SwissprotQ67UX62e-38HOX26_ORYSJ; Putative homeobox-leucine zipper protein HOX26
TrEMBLJ3L9L29e-43J3L9L2_ORYBR; Uncharacterized protein
STRINGOB02G13290.12e-42(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP83153249
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16780.12e-27homeobox protein 2